PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00418.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 801aa    MW: 88934.6 Da    PI: 7.9117
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00418.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10644703463
                              XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                               kr +r   NR++A rs +RK  +++eLe kv +L+ eN aL   + +l  ++  l++++
  Rsa1.0_00418.1_g00016.1 644 PKRVKRILANRLSAARSKERKMLYTAELEHKVHTLQRENAALSAHVTHLHGHSTGLQNQN 703
                              5999*****************************************999998887777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0095267331IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.4E-5268344No hitNo description
SMARTSM003381.3E-14641705IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.277643706IPR004827Basic-leucine zipper domain
PfamPF077164.0E-10643691IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.58E-10645700No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-11645693No hitNo description
CDDcd147031.82E-19646692No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 801 aa     Download sequence    Send to blast
MNRQAETAPF VLSTQFPCPP PPPNGQKRGN MPPPRRSSLP PLPPKRPTTT RQQTEFQNFN  60
PGPRLPPQSP VFGSLPPIMS PAPPSWSSYQ GFQSAPPVAY HNQALPQLPF TGPPTPSVSA  120
HRRASYGDNN SAGFPSMDAM NMIYPEPMEM PVGVNYSNQG HGDKEFGIGE PSGFMDEYVT  180
AYPDLDNIFD FSIKNDDVER ITSGSSKNKR KATTSSDVSP SRSVRRKSVD CNNLNNGSSS  240
IGIGNWMFTE SQMDEIARCD TLKKLVSTDP KSVKRILTNR ETSRRTQERK AQQVLDLEEM  300
VETLEKEVCT VAAHTSIAER TKLGLEEDNK QMRIRIQEME EQAKVANEGN RRGNPKQGDD  360
NGRRHVGATE TVRGADDRLL WFRMKRSSIL SKEVERVVEL YFFRDMMMRP NSSSSSSVPN  420
QHLNRVPLPY TGDRVGAPSP IPPATLPPNH SMPAMEEITV AGFSPYLPPS PFTMYHPTSR  480
MVAGGENILP PPGKSHMRSN SDDVTFGFSS MMPQPLNSLP PLVPSKPLER SISGGREVSA  540
FRGRTSESEY DIIRAYMEEE MESGRGTTRK KTNGGSGGEG IASPACGHYR SVSLDSCFLG  600
RPSSNSGEGE GAYSVEFGDC EFSPDEIERI TADEKLAEIV VAEPKRVKRI LANRLSAARS  660
KERKMLYTAE LEHKVHTLQR ENAALSAHVT HLHGHSTGLQ NQNSELRFRL QAMEQQAHLR  720
NALSEKLTEE VQRLRLFIGV PSGSESNISK TSLNPEMFEQ QLRISQLQHQ HSNQNNSTMN  780
ANPASNGYFS QLSDDPQFRH I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894805e-47AC189480.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB082F21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603790.11e-120PREDICTED: transcription factor RF2b-like
TrEMBLA0A0D3DW911e-120A0A0D3DW91_BRAOL; Uncharacterized protein
STRINGBra031172.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2035456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.13e-85bZIP family protein